DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pad and ZFP42

DIOPT Version :9

Sequence 1:NP_650534.2 Gene:pad / 41981 FlyBaseID:FBgn0038418 Length:924 Species:Drosophila melanogaster
Sequence 2:NP_001291287.1 Gene:ZFP42 / 132625 HGNCID:30949 Length:310 Species:Homo sapiens


Alignment Length:183 Identity:46/183 - (25%)
Similarity:74/183 - (40%) Gaps:47/183 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   639 PVSVPALSQAQPPPLAAQHKKIVRKPPENQD--------------TSGQKVKAARPPQQILPSPQ 689
            |..:|.:..:.|..||...:|   |||.|::              |...:.:||.....::..|:
Human   154 PGGIPGIDLSDPKQLAEFARK---KPPINKEYDSLSAIACPQSGCTRKLRNRAALRKHLLIHGPR 215

  Fly   690 QEGQNATHSGSEAPTTSGLICPTCKREFKKKEHLTQHVKLHAGLRPFKCSEEGCDKTFSRKEHLS 754
            ..                 :|..|.:.|.:...|.:|..:|.|.:||:|:.|||.|.||...:|.
Human   216 DH-----------------VCAECGKAFVESSKLKRHFLVHTGEKPFRCTFEGCGKRFSLDFNLR 263

  Fly   755 RHLVSHSGQKMYTC--EVCKKPFSRKDNLNKHRRIHTQTSTETLYCCDVCNKN 805
            .|:..|:|:|.:.|  :.|.:.|.:.:||..|...|..|           |||
Human   264 THVRIHTGEKRFVCPFQGCNRRFIQSNNLKAHILTHANT-----------NKN 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
padNP_650534.2 zf-AD 16..87 CDD:214871
C2H2 Zn finger 710..730 CDD:275368 5/19 (26%)
zf-C2H2 736..760 CDD:278523 10/23 (43%)
C2H2 Zn finger 738..760 CDD:275368 9/21 (43%)
zf-H2C2_2 752..777 CDD:290200 8/26 (31%)
zf-C2H2 766..788 CDD:278523 6/23 (26%)
C2H2 Zn finger 768..788 CDD:275368 6/21 (29%)
zf-H2C2_2 780..808 CDD:290200 8/26 (31%)
C2H2 Zn finger 799..819 CDD:275368 3/7 (43%)
ZFP42NP_001291287.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35
C2H2 Zn finger 190..212 CDD:275368 3/21 (14%)
COG5048 214..>307 CDD:227381 33/120 (28%)
C2H2 Zn finger 219..239 CDD:275368 5/19 (26%)
zf-H2C2_2 232..257 CDD:290200 11/24 (46%)
C2H2 Zn finger 247..269 CDD:275368 9/21 (43%)
zf-H2C2_2 261..288 CDD:290200 8/26 (31%)
C2H2 Zn finger 277..299 CDD:275368 6/21 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.