DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17930 and CG33282

DIOPT Version :9

Sequence 1:NP_650533.1 Gene:CG17930 / 41979 FlyBaseID:FBgn0038416 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_001097067.1 Gene:CG33282 / 2768939 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster


Alignment Length:511 Identity:112/511 - (21%)
Similarity:197/511 - (38%) Gaps:107/511 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 TYITNGRQQQPPPPPPPTTVIITTQSNSR-----WATPTQTQSGTAATLLFVYAGMDMAQGLGWN 86
            |::.|...||........|||:...:...     |.:||.|:..||.:.|      |....|.  
  Fly     3 TFLKNSLLQQKTRYQLLATVIVNIITFGHGVGVGWLSPTLTKIQTADSPL------DFEVNLA-- 59

  Fly    87 LTAVSANTLEFQYSWFIGVIIG--AVVSAITSAFL-----PKIVFYGLGGVMNLIDAIIFVSAPY 144
                       |.|| :|.::|  ::...:|.|.|     .|...|.:.|....|..:|:.::..
  Fly    60 -----------QISW-LGSMLGLDSLCGNLTIAMLIERAGRKFCLYLMAGPYACIWILIYCASNV 112

  Fly   145 EYESILAARYVGGV--GIGLITVPFLIHSAEIASSTNRGTCCALEQYGLALGVAIQVIYDSQWSQ 207
            .|  :.|||::.|.  |.|.:.||..|  :|:|.|..||...::....:.||:....|..:..:.
  Fly   113 YY--LYAARFLCGFTGGAGYLVVPIFI--SEVADSNIRGALTSMVMLSVDLGILAGYILSTYLAY 173

  Fly   208 G----LGMTINRVHGIFGIVFTAIA-----LGSVAITIDSPIFYIRQNQ---EQKARASVKQL-- 258
            .    |.:.:...:.|..|:....|     ...:|...:|..:|..|..   ||.::.:.::|  
  Fly   174 HVVPFLAIILPVAYFIANIMLPETAPYLLKKSQLAAAENSFRYYRNQRSAICEQTSKVNFEELRT 238

  Fly   259 -MGSYWTREAGDRAY-DEAKLYVVEGSAQGVGEQLGESMMPFLKLLLFRCFVAFTFSVPLSYSIL 321
             :.|..||.|...:| |......::|.|..:...||   ..|..:..|..:::..|....|...:
  Fly   239 AVLSQQTRNATPLSYKDLTTKPALKGFAASIVLSLG---YQFSGVFSFINYMSDIFKASGSVVDV 300

  Fly   322 TTTELVEGTLHSWPTIIFGLLRLIGALITFAVLDTVGRKFVSLL-----GLMCMA-GLMLGMAGV 380
            .|.           |||.||::::|...:..::|.|||:.:.|:     |:.|:| |....:|.:
  Fly   301 NTA-----------TIIIGLVQIVGVYTSTILVDIVGRRVLMLISTMGVGIGCIAFGCFTYLAKI 354

  Fly   381 YGDYGHIFDDYFMW----------QVCRLGMAFQFFAGFFICSSSAYLGEAFPMRVKPFLIGLIV 435
            |.     ..| |.|          .|..:|:...||         ..|.|.||::::.....|.|
  Fly   355 YD-----LSD-FNWLPLVLMIIICYVANIGLIGIFF---------LVLVELFPVKIRSLATSLSV 404

  Fly   436 CLEQVIHIIVIVKFVPTAEFYY-----TYFVAVGIIMVIGLVAFAVLMPETRGLTL 486
            ....:: :...:|..|....|:     .:|.|...::.  ...|.:.:.||:|.::
  Fly   405 IFLSLL-VFGTLKLFPLMLHYWGISFTMWFSAASALLT--FFYFWLFLQETKGKSM 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17930NP_650533.1 Sugar_tr 102..493 CDD:278511 93/431 (22%)
CG33282NP_001097067.1 MFS 21..448 CDD:119392 105/482 (22%)
MFS_1 53..409 CDD:284993 89/402 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444510
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.