DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6901 and AMF1

DIOPT Version :9

Sequence 1:NP_650531.1 Gene:CG6901 / 41977 FlyBaseID:FBgn0038414 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_015023.1 Gene:AMF1 / 854560 SGDID:S000005905 Length:515 Species:Saccharomyces cerevisiae


Alignment Length:229 Identity:43/229 - (18%)
Similarity:69/229 - (30%) Gaps:93/229 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 YASYTV--FFLFIYGGMDMAASL---------------------GWSQPYSVLLFTEYSYCW--- 86
            ||...|  |||.|:..::..|:.                     ||:. :.:.:|    |.|   
Yeast   275 YALLIVGTFFLVIFAYIESRAAFPLLPFAALSSDTAFVLSCIAAGWAS-FGIWIF----YTWQFM 334

  Fly    87 --------------FVGVIIGALATTLTMSFL----PKLVYYVFGALMQLTGSIIFTAADYSACL 133
                          |..|.|......:|..||    |.....:|.......|:|:...|.    :
Yeast   335 EDSRGQTPLLSSAQFSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAP----V 395

  Fly   134 AARYLAGLGIGLITVPFLIHNAEVASNNLRGVNGGMEQCGLALGIFFQVIFTTEWTSLIDSNPNE 198
            ...|.|...:.:|.:|:                 ||:           :.|......|.||.|:|
Yeast   396 HQTYWAQTFVSIIVMPW-----------------GMD-----------MSFPAATIMLSDSMPHE 432

  Fly   199 IHGIIGIVVSL---------FGLAMTALVVESPI 223
            ..|:...:|:.         .|:|.|   :||.:
Yeast   433 HQGLAASLVNTVVNYSISIGLGIAGT---IESRV 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6901NP_650531.1 Sugar_tr 85..469 CDD:278511 31/169 (18%)
MFS <272..457 CDD:119392
AMF1NP_015023.1 MFS_Amf1_MDR_like 48..493 CDD:341029 43/229 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.