DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6901 and VBA3

DIOPT Version :9

Sequence 1:NP_650531.1 Gene:CG6901 / 41977 FlyBaseID:FBgn0038414 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_009864.1 Gene:VBA3 / 850290 SGDID:S000000574 Length:458 Species:Saccharomyces cerevisiae


Alignment Length:309 Identity:71/309 - (22%)
Similarity:118/309 - (38%) Gaps:70/309 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KPAVTTNNRGYFTRINKQ-NYASYT--VFFLFIYGGMDMAAS------LGWSQPYSVLLFTEYSY 84
            |.|:.|.:...|::...| |:....  :.|.|.:.|..:.::      ||       |.|....|
Yeast   100 KDAIGTISSFTFSKFRHQVNFKRLMNGIIFKFDFFGFALCSAGLVLFLLG-------LTFGGNKY 157

  Fly    85 CWFVGVIIGALATTLTMSFLPKLVY--YVFGALMQLTGSIIFTAADYSACLAARYLAGLGIGLIT 147
            .|..|.:|..|...:.: |:..|||  ::|........:|     .|...|..|.:|...|.:|.
Yeast   158 SWNSGQVIAYLVLGVLL-FIFSLVYDFFLFDKFNPEPDNI-----SYRPLLLRRLVAKPAIIIIN 216

  Fly   148 -VPFLIHNAEVASNNLRGVNGGMEQCGLALGIFFQVIF-TTEWTSLIDSNPNEIHGII-----GI 205
             |.||:         ..|.||.|    :....|||:|| ::.|.:.:...|..|..:|     |:
Yeast   217 MVTFLL---------CTGYNGQM----IYSVQFFQLIFASSAWKAGLHLIPIVITNVIAAIASGV 268

  Fly   206 VVSLFGLAMTAL-------VVESPIFFLRRNMENRAQQSQEKLLRHNPG-----GVSAALKEARR 258
            :....||....|       |:.:.:..|..|...::.|....||   ||     .:.|:|..|:.
Yeast   269 ITKKLGLVKPLLIFGGVLGVIGAGLMTLMTNTSTKSTQIGVLLL---PGFSLGFALQASLMSAQL 330

  Fly   259 YVAESDNRTLGEELVASVMPFLKMLLFRCFVAFSFSLPLTMSIISSTAV 307
            .:.        ::...:.|.|:::..|..|:.   ||..|:..:.||.|
Yeast   331 QIT--------KDRPEAAMDFIEVTAFNTFMK---SLGTTLGGVLSTTV 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6901NP_650531.1 Sugar_tr 85..469 CDD:278511 57/244 (23%)
MFS <272..457 CDD:119392 10/36 (28%)
VBA3NP_009864.1 MFS <1..369 CDD:421695 71/309 (23%)
MFS <1..>181 CDD:421695 20/88 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.