DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6901 and Slc2a13

DIOPT Version :9

Sequence 1:NP_650531.1 Gene:CG6901 / 41977 FlyBaseID:FBgn0038414 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001028805.2 Gene:Slc2a13 / 239606 MGIID:2146030 Length:637 Species:Mus musculus


Alignment Length:500 Identity:92/500 - (18%)
Similarity:171/500 - (34%) Gaps:151/500 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 GVIIGALATTLTMSFLPKLVYYVFGALMQLTGSIIFTAADYSACLAARYLAGLGIGLITVPFLIH 153
            |.:.|||..        :....:..||..:..:::..||:....||.|.:.|||||:.::...::
Mouse   128 GALNGALGR--------RSAILLASALCTVGSAVLAAAANKETLLAGRLVVGLGIGIASMTVPVY 184

  Fly   154 NAEVASNNLRG---------VNGGMEQCGLALGIFFQVIFTTEWTSLIDSNPNEIHGIIGI--VV 207
            .|||:..||||         :.||.         ||..:....::.|.......:.|:..|  |:
Mouse   185 IAEVSPPNLRGRLVTINTLFITGGQ---------FFASVVDGAFSYLQKDGWRYMLGLAAIPAVI 240

  Fly   208 SLFGLAMTALVVESPIFFLRRNMENRAQQSQEKLLRHNPGG--VSAALKEARRYVAESDNR-TLG 269
            ...|.   ..:.|||.:.:::....:|:    ::|....|.  :.......|..:.|.:.. |..
Mouse   241 QFLGF---LFLPESPRWLIQKGQTQKAR----RILSQMRGNQTIDEEYDSIRNSIEEEEKEATAA 298

  Fly   270 EELVASVM---PFLKMLLFRCFVAFSFSLP-------LTMSIISSTAVAEKGLSLWPIYLFGVLR 324
            ..::..::   |..:.|:..|.:.....|.       .:.:|:..:.|.:..|::|...:.....
Mouse   299 GPIICRMLSYPPTRRALVVGCGLQMFQQLSGINTIMYYSATILQMSGVEDDRLAIWLASITAFTN 363

  Fly   325 VIGVMVALIFLDTLGRK-------AVSLVGLLVMAGLMLGLAGLYANVTNLISFNLMT------- 375
            .|..:|.:..::.:||:       |.:.|.|:::|   ||.. |.|.|:..::|...|       
Mouse   364 FIFTLVGVWLVEKVGRRKLTFGSLAGTTVALIILA---LGFL-LSAQVSPRVTFRPTTPSDQNTT 424

  Fly   376 ----SACN-------IALAFQVFAGLFVCSSS-----------------------------AY-- 398
                |.||       ....:::.....:.||.                             ||  
Mouse   425 CTGYSYCNECMLDPDCGFCYKINGSAVIDSSCVPVNKASTTEAAWGRCDNETKFKAEGAHWAYSF 489

  Fly   399 -----------------------MG--------EAFPMRVKS----FLVGVIVIIEQIVHIVVIA 428
                                   ||        |.:|:..:|    ...|:..|...:|.:..:.
Mouse   490 CPTPYSWTALVGLVLYLVFFAPGMGPMPWTVNSEIYPLWARSTGNACSAGINWIFNVLVSLTFLH 554

  Fly   429 CVSSVPNKDFFFQY--FLAVGIIMLVGMIFFTVSMPETKKMTLRK 471
            ....:.....||.|  |.|||::.:.|      .:||||...|.:
Mouse   555 TAEYLTYYGAFFLYAGFAAVGLLFVYG------CLPETKGKKLEE 593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6901NP_650531.1 Sugar_tr 85..469 CDD:278511 91/496 (18%)
MFS <272..457 CDD:119392 46/287 (16%)
Slc2a13NP_001028805.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 15..38
MFS 75..580 CDD:119392 86/479 (18%)
Sugar_tr 78..598 CDD:278511 92/499 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834281
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.