DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6901 and K09C4.4

DIOPT Version :9

Sequence 1:NP_650531.1 Gene:CG6901 / 41977 FlyBaseID:FBgn0038414 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001361998.1 Gene:K09C4.4 / 187194 WormBaseID:WBGene00019549 Length:524 Species:Caenorhabditis elegans


Alignment Length:193 Identity:37/193 - (19%)
Similarity:79/193 - (40%) Gaps:59/193 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 SLPLTMSIISSTAVAEKGLSLWPIYLFGVLRVIGVMVALIFL----DTLGRKAVSLVGLLVMAGL 354
            |:.:..|:|:|:                  ..:|.:::||||    ||.|||.:    ::.|...
 Worm    57 SISIMNSMITSS------------------ETVGTLLSLIFLIPMADTKGRKFL----VIYMRSA 99

  Fly   355 MLGLAGLYANVTNLISFNLMTSACNIALAFQVFAGLFVCS--------------SSAYMGEAFPM 405
            :|                ::::.|.:..|:...|..|:.|              ::.::.|..|.
 Worm   100 LL----------------ILSALCQVLSAYSQSAEFFIMSKLFEGLQHPLGTFLTALFIAECAPD 148

  Fly   406 RVKSFLVGVIVIIEQIVHIVV--IACVSSVPNKDFFFQYFLAVGIIMLVGMIFFTVSMPETKK 466
            :.:.|....:|::..||.:::  ||..:.:...|.:|.:.|| .:|....::.:...:||:.|
 Worm   149 KNRGFACTSLVVLVGIVRMIMLPIASPAVLGKADTWFVFPLA-ALISSFLVLIWVCRLPESPK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6901NP_650531.1 Sugar_tr 85..469 CDD:278511 37/193 (19%)
MFS <272..457 CDD:119392 34/182 (19%)
K09C4.4NP_001361998.1 MFS 42..462 CDD:391944 37/193 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158171
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.