DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip89B and Slc39a3

DIOPT Version :9

Sequence 1:NP_536747.2 Gene:Zip89B / 41975 FlyBaseID:FBgn0038412 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001008357.1 Gene:Slc39a3 / 314637 RGDID:1310863 Length:317 Species:Rattus norvegicus


Alignment Length:368 Identity:108/368 - (29%)
Similarity:166/368 - (45%) Gaps:68/368 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 SGVLVAKVTAMVVLFCASAICGSIPFLLNRCYRWTENQTNARSAIVVKCLLYFGGGVLLATTFLH 114
            |.:|||||..||.:|....:...:|..:..    .:.:...||..|:.....|||||.|||.|..
  Rat     2 SQLLVAKVLCMVGVFFFMLLGSLLPVKVIE----ADFEKAHRSKKVLSLCNTFGGGVFLATCFNA 62

  Fly   115 LLPEVQEVVEELQECGIIGELTFPLAELLMCCGFFLMYFIEEAMHTYVHHHQKDEAGAAFERGHS 179
            |||.|::.::::...|.| ...:||||.||..||||..|:|:.:.|:..           ||   
  Rat    63 LLPAVRDKLQQVLSLGHI-STDYPLAETLMMVGFFLTVFVEQLVLTFRR-----------ER--- 112

  Fly   180 IRNSHLLKPTEGNATTPTAPPAPLAGTAELGTLSVQNLLQNDLEQQKFATKPQQQANGHGH---- 240
                               ||     ..:|.|.:..:...:|.|.:    .|.....|..|    
  Rat   113 -------------------PP-----FIDLETFNAGSDAGSDSEYE----SPFVGVGGRNHGLYP 149

  Fly   241 ---SHGHGHGHSHLPVIADDADAGDMLASSLRGLFIVSALSLHELFEGMAIGLESSASSVWFMFG 302
               :|.||.|..    :.:....|     .||.|.:|.|||.|.:|||:|:||:.....|..:|.
  Rat   150 EPTAHSHGTGLR----LRELGRPG-----PLRLLSLVFALSAHSVFEGLALGLQEEGERVVSLFV 205

  Fly   303 AVSAHKLVLAFCVGVELIVARTRMLLAVLYVLTFAVVSPLGIGIGILINHGEETSGPSLVSAILQ 367
            .|:.|:.::|..:|:.:..:...:..|....:|.:.:.|:|||:|:.|......:. |:.||:||
  Rat   206 GVAVHETLVAVALGISMARSAVPLRDAAKLAVTVSAMIPVGIGLGLGIESARSVAS-SVASALLQ 269

  Fly   368 GFACGTLIYVVFFEILSK---NRS-GLRAYLALFVGFLVMFGL 406
            |.|.||.::|.|.|||:|   .|| .|...|.|.:|:.|:.|:
  Rat   270 GLAGGTFLFVTFLEILAKELEERSEQLLKVLFLVLGYAVLAGM 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip89BNP_536747.2 Zip 53..406 CDD:280666 106/363 (29%)
Slc39a3NP_001008357.1 Zip 5..312 CDD:396884 106/363 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I5803
eggNOG 1 0.900 - - E1_KOG1558
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H44230
Inparanoid 1 1.050 118 1.000 Inparanoid score I4700
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D471714at33208
OrthoFinder 1 1.000 - - FOG0000574
OrthoInspector 1 1.000 - - mtm9105
orthoMCL 1 0.900 - - OOG6_100840
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X561
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.770

Return to query results.
Submit another query.