DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip89B and SLC39A3

DIOPT Version :9

Sequence 1:NP_536747.2 Gene:Zip89B / 41975 FlyBaseID:FBgn0038412 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_653165.2 Gene:SLC39A3 / 29985 HGNCID:17128 Length:314 Species:Homo sapiens


Alignment Length:362 Identity:108/362 - (29%)
Similarity:173/362 - (47%) Gaps:63/362 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VLVAKVTAMVVLFCASAICGSIPFLLNRCYRWTENQTNARSAIVVKCLLYFGGGVLLATTFLHLL 116
            :||||:..||.:|....:...:|..:..    |:.:...||..::.....|||||.|||.|..||
Human     4 LLVAKILCMVGVFFFMLLGSLLPVKIIE----TDFEKAHRSKKILSLCNTFGGGVFLATCFNALL 64

  Fly   117 PEVQEVVEELQECGIIGELTFPLAELLMCCGFFLMYFIEEAMHTYVHHHQKDEAGAAFERGHSIR 181
            |.|:|.::::...|.| ...:||||.::..|||:..|:|:.:.|:    :|:             
Human    65 PAVREKLQKVLSLGHI-STDYPLAETILLLGFFMTVFLEQLILTF----RKE------------- 111

  Fly   182 NSHLLKPTEGNATTPTAPPAPLAGTAELGTLSVQNLLQNDLEQQKFATKPQQQANGHG-HSHGHG 245
                 ||:                ..:|.|.:..:.:.:|.|   :.:.....|.||. :...||
Human   112 -----KPS----------------FIDLETFNAGSDVGSDSE---YESPFMGGARGHALYVEPHG 152

  Fly   246 HGHSHLPVIADDADAGDMLASSLRGLFIVSALSLHELFEGMAIGLESSASSVWFMFGAVSAHKLV 310
            ||.| |.|      .|...||.:|.|.:..|||.|.:|||:|:||:.....|..:|..|:.|:.:
Human   153 HGPS-LSV------QGLSRASPVRLLSLAFALSAHSVFEGLALGLQEEGEKVVSLFVGVAVHETL 210

  Fly   311 LAFCVGVELIVARTRMLL--AVLYVLTFAVVSPLGIGIGILINHGEETSGPSLVSAILQGFACGT 373
            :|..:|:.:  ||:.|.|  |....:|.:.:.|||||:|:.|...:...| |:.|.:|||.|.||
Human   211 VAVALGISM--ARSAMPLRDAAKLAVTVSAMIPLGIGLGLGIESAQGVPG-SVASVLLQGLAGGT 272

  Fly   374 LIYVVFFEILSK----NRSGLRAYLALFVGFLVMFGL 406
            .:::.|.|||:|    ....|...|.|.:|:.|:.|:
Human   273 FLFITFLEILAKELEEKSDRLLKVLFLVLGYTVLAGM 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip89BNP_536747.2 Zip 53..406 CDD:280666 107/359 (30%)
SLC39A3NP_653165.2 Zip 5..309 CDD:396884 107/359 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1558
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H44230
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D471714at33208
OrthoFinder 1 1.000 - - FOG0000574
OrthoInspector 1 1.000 - - mtm8626
orthoMCL 1 0.900 - - OOG6_100840
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X561
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.680

Return to query results.
Submit another query.