DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment asun and LOC100497319

DIOPT Version :9

Sequence 1:NP_524379.2 Gene:asun / 41971 FlyBaseID:FBgn0020407 Length:689 Species:Drosophila melanogaster
Sequence 2:XP_002934145.1 Gene:LOC100497319 / 100497319 -ID:- Length:255 Species:Xenopus tropicalis


Alignment Length:205 Identity:44/205 - (21%)
Similarity:70/205 - (34%) Gaps:72/205 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 SDYSVIHGL---RAAIEALAEPTDEQLAAMADFGTDELPRIPNKGRVICITSARDNTSMKSLEDI 189
            |..||:.|:   |||:.|    .|.|...:....|:.. .:..||     |:....||.:..|..
 Frog    88 SGLSVMVGVGTGRAALHA----GDFQFVNLLGMDTESW-GLSYKG-----TAWHGGTSRRYTEPF 142

  Fly   190 FNTVLVQQNTLAAPPSKKGLVIDHCHLVILNIVPLGVESLVTNRSLLKI---------SPLLDVE 245
            :               :||.||.    |.||| ..|..:...||..|.:         |||..:.
 Frog   143 Y---------------EKGTVIG----VHLNI-DEGTLAFYRNRQSLGVAFTGLQKVQSPLYPMV 187

  Fly   246 IHTVSAPDISYKLTHLILNHYDLASTTVTNIPMKEEQ----NANSSANYDVEILHSRRAHSITCG 306
            ..|....:::..|             ..:.:|..:|:    .|:|.|..|:          :.|.
 Frog   188 SSTSPGTELAVGL-------------QCSTLPSLQERCLSTLAHSLAQKDM----------VDCL 229

  Fly   307 PDFSLPTSIK 316
            |   ||.:::
 Frog   230 P---LPAAVR 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
asunNP_524379.2 DUF2151 5..665 CDD:287224 44/205 (21%)
LOC100497319XP_002934145.1 SPRY_SOCS3 30..217 CDD:293936 36/171 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165161449
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.