DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mtSSB and RIM1

DIOPT Version :9

Sequence 1:NP_536744.2 Gene:mtSSB / 41968 FlyBaseID:FBgn0010438 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_009958.2 Gene:RIM1 / 850395 SGDID:S000007222 Length:135 Species:Saccharomyces cerevisiae


Alignment Length:102 Identity:24/102 - (23%)
Similarity:47/102 - (46%) Gaps:14/102 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VTILGRVGADPQLRGSQEHPVVTFSVATHTNY-KYENGDWAQR---TDWHRVVVFKPNLRDTVLE 101
            ::|:||:|::     ..||     :.|.:..| ||......:|   |:|:.:.||.....:.:.|
Yeast    22 MSIVGRIGSE-----FTEH-----TSANNNRYLKYSIASQPRRDGQTNWYNITVFNEPQINFLTE 76

  Fly   102 YLKKGQRTMVQGKITYGEITDQQGNQKTSTSIIADDV 138
            |::||....|:............|::.|:.|::..|:
Yeast    77 YVRKGALVYVEADAANYVFERDDGSKGTTLSLVQKDI 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtSSBNP_536744.2 SSB 38..141 CDD:278844 24/102 (24%)
Ssb 38..>140 CDD:223702 24/102 (24%)
RIM1NP_009958.2 SSB 19..116 CDD:395349 24/102 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101436
Panther 1 1.100 - - LDO PTHR10302
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.