DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mtSSB and PTAC9

DIOPT Version :9

Sequence 1:NP_536744.2 Gene:mtSSB / 41968 FlyBaseID:FBgn0010438 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001031674.1 Gene:PTAC9 / 827746 AraportID:AT4G20010 Length:371 Species:Arabidopsis thaliana


Alignment Length:127 Identity:26/127 - (20%)
Similarity:47/127 - (37%) Gaps:22/127 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LTGLRNLPARGATTTT---AAAPAKV---EKTVNTVTILGRVGADPQLRGSQEHPVVTFSVATHT 70
            :|.::.|.....|.||   ...|.::   .:..|.|.::|.|....|...|.:......:|.:..
plant    66 VTPVKPLEIASVTATTENELPRPNEIAYESEVANWVNLIGFVDQPVQFEASSDGKFWAGTVISQR 130

  Fly    71 NYKYENGDWAQRTDWHRVVVFKPNLRDTVLEYLKKGQRTMVQGKI---------TYGEITDQ 123
            :....:|.|..       ::|:.:|..|...|:.|..:..|.||:         ||.:...|
plant   131 SASDSSGFWIP-------IIFEGDLAKTAARYVSKDDQIHVSGKLFIDSPPPNMTYAQANVQ 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtSSBNP_536744.2 SSB 38..141 CDD:278844 20/95 (21%)
Ssb 38..>140 CDD:223702 20/95 (21%)
PTAC9NP_001031674.1 RPA_2b-aaRSs_OBF_like 101..>172 CDD:299125 16/77 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10302
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.