DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mtSSB and SSBP1

DIOPT Version :9

Sequence 1:NP_536744.2 Gene:mtSSB / 41968 FlyBaseID:FBgn0010438 Length:146 Species:Drosophila melanogaster
Sequence 2:XP_005250105.1 Gene:SSBP1 / 6742 HGNCID:11317 Length:159 Species:Homo sapiens


Alignment Length:145 Identity:58/145 - (40%)
Similarity:87/145 - (60%) Gaps:16/145 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PLLTGLRNLPARGATTTTAAAPAKVEKTVNTVTILGRVGADPQLRGSQ-EHPVVTFSVATHTNYK 73
            |:|..||......:.|||:..   :|:::|.|.:|||||.||.||..: ::||..||:||:..::
Human     5 PVLQVLRQFVRHESETTTSLV---LERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWR 66

  Fly    74 ------YENGDWAQRTDWHRVVVFKPNLRDTVLEYLKKGQRTMVQGKITYGEITDQQGNQKTSTS 132
                  |:.||.:|:|.|||:.||:|.|||...:|:|||.|..::|||.|||..|:...::.:|:
Human    67 SGDSEVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATT 131

  Fly   133 IIADD------VLFF 141
            |||..      |.||
Human   132 IIAGKKLVKIAVFFF 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtSSBNP_536744.2 SSB 38..141 CDD:278844 48/115 (42%)
Ssb 38..>140 CDD:223702 48/114 (42%)
SSBP1XP_005250105.1 ssb 27..>134 CDD:273179 46/106 (43%)
Ssb 29..>134 CDD:223702 45/104 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147654
Domainoid 1 1.000 100 1.000 Domainoid score I7048
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H74462
Inparanoid 1 1.050 110 1.000 Inparanoid score I4896
Isobase 1 0.950 - 0 Normalized mean entropy S5273
OMA 1 1.010 - - QHG46240
OrthoDB 1 1.010 - - D1304218at2759
OrthoFinder 1 1.000 - - FOG0004077
OrthoInspector 1 1.000 - - oto91288
orthoMCL 1 0.900 - - OOG6_101436
Panther 1 1.100 - - LDO PTHR10302
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2656
SonicParanoid 1 1.000 - - X5103
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1514.890

Return to query results.
Submit another query.