DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mtSSB and Ssbp1

DIOPT Version :9

Sequence 1:NP_536744.2 Gene:mtSSB / 41968 FlyBaseID:FBgn0010438 Length:146 Species:Drosophila melanogaster
Sequence 2:XP_008761044.1 Gene:Ssbp1 / 54304 RGDID:3760 Length:151 Species:Rattus norvegicus


Alignment Length:114 Identity:49/114 - (42%)
Similarity:75/114 - (65%) Gaps:7/114 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 AAPAKVEKTVNTVTILGRVGADPQLRGSQ-EHPVVTFSVATH------TNYKYENGDWAQRTDWH 86
            |:...:|:::|.|.:|||||.||.:|..: ::||..||:||:      .|..|:.||.:|:|.||
  Rat    21 ASSLVLERSLNRVQLLGRVGQDPVMRQVEGKNPVTIFSLATNEMWRSGDNEAYQMGDVSQKTTWH 85

  Fly    87 RVVVFKPNLRDTVLEYLKKGQRTMVQGKITYGEITDQQGNQKTSTSIIA 135
            |:.||:|.|||...:|:|||.|..|:||:.|||..|:...::.:|:|||
  Rat    86 RISVFRPGLRDVAYQYVKKGARIFVEGKVDYGEYMDKNNVRRQATTIIA 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtSSBNP_536744.2 SSB 38..141 CDD:278844 47/105 (45%)
Ssb 38..>140 CDD:223702 47/105 (45%)
Ssbp1XP_008761044.1 RPA_2b-aaRSs_OBF_like 27..>142 CDD:299125 48/108 (44%)
Ssb 29..>134 CDD:223702 45/104 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341476
Domainoid 1 1.000 101 1.000 Domainoid score I6793
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H74462
Inparanoid 1 1.050 107 1.000 Inparanoid score I4830
OMA 1 1.010 - - QHG46240
OrthoDB 1 1.010 - - D1304218at2759
OrthoFinder 1 1.000 - - FOG0004077
OrthoInspector 1 1.000 - - oto98370
orthoMCL 1 0.900 - - OOG6_101436
Panther 1 1.100 - - LDO PTHR10302
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5103
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.