DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mtSSB and Ssbp1

DIOPT Version :9

Sequence 1:NP_536744.2 Gene:mtSSB / 41968 FlyBaseID:FBgn0010438 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_082634.1 Gene:Ssbp1 / 381760 MGIID:1920040 Length:152 Species:Mus musculus


Alignment Length:114 Identity:48/114 - (42%)
Similarity:76/114 - (66%) Gaps:7/114 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 AAPAKVEKTVNTVTILGRVGADPQLRGSQ-EHPVVTFSVATHTNYK------YENGDWAQRTDWH 86
            |:...:|:::|.|.:|||||.||.:|..: ::||..||:||:..::      |:.||.:|:|.||
Mouse    21 ASSLVLERSLNRVQLLGRVGQDPVMRQVEGKNPVTIFSLATNEMWRSGDSEVYQMGDVSQKTTWH 85

  Fly    87 RVVVFKPNLRDTVLEYLKKGQRTMVQGKITYGEITDQQGNQKTSTSIIA 135
            |:.||:|.|||...:|:|||.|..|:||:.|||..|:...::.:|:|||
Mouse    86 RISVFRPGLRDVAYQYVKKGARIFVEGKVDYGEYMDKNNVRRQATTIIA 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtSSBNP_536744.2 SSB 38..141 CDD:278844 46/105 (44%)
Ssb 38..>140 CDD:223702 46/105 (44%)
Ssbp1NP_082634.1 RPA_2b-aaRSs_OBF_like 27..>134 CDD:385638 45/106 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837735
Domainoid 1 1.000 94 1.000 Domainoid score I7518
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H74462
Inparanoid 1 1.050 96 1.000 Inparanoid score I5028
Isobase 1 0.950 - 0 Normalized mean entropy S5273
OMA 1 1.010 - - QHG46240
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004077
OrthoInspector 1 1.000 - - oto94867
orthoMCL 1 0.900 - - OOG6_101436
Panther 1 1.100 - - LDO PTHR10302
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2656
SonicParanoid 1 1.000 - - X5103
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.880

Return to query results.
Submit another query.