DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mtSSB and mtss-1

DIOPT Version :9

Sequence 1:NP_536744.2 Gene:mtSSB / 41968 FlyBaseID:FBgn0010438 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_498935.1 Gene:mtss-1 / 187502 WormBaseID:WBGene00019800 Length:170 Species:Caenorhabditis elegans


Alignment Length:105 Identity:37/105 - (35%)
Similarity:61/105 - (58%) Gaps:4/105 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TVNTVTILGRVGADPQLR-GSQEHPVVTFSVATHTNYKYENGDWAQRTDWHRVVVFKPNLRDTVL 100
            :||.|.::|.|..||..: |....|.:.|::.|::.:|.::|....:|:.|.|.||... .:.:.
 Worm    53 SVNKVELVGGVALDPLYKTGRNGKPYLIFNIITNSYFKQQDGTTLDQTERHAVSVFGKQ-AEILS 116

  Fly   101 EYLKKGQRTMVQGKITY-GEITDQQGNQ-KTSTSIIADDV 138
            :.:|||.|.||||::.| |...|:|||: :.:|.|||..|
 Worm   117 KTIKKGSRLMVQGRLHYSGGQKDEQGNRTQRNTYIIAQTV 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtSSBNP_536744.2 SSB 38..141 CDD:278844 37/104 (36%)
Ssb 38..>140 CDD:223702 37/104 (36%)
mtss-1NP_498935.1 Ssb 53..>170 CDD:223702 37/105 (35%)
SSB 54..159 CDD:278844 37/104 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159652
Domainoid 1 1.000 57 1.000 Domainoid score I7300
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I4051
Isobase 1 0.950 - 0 Normalized mean entropy S5273
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004077
OrthoInspector 1 1.000 - - oto20292
orthoMCL 1 0.900 - - OOG6_101436
Panther 1 1.100 - - LDO PTHR10302
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2656
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.870

Return to query results.
Submit another query.