DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6126 and CG4324

DIOPT Version :9

Sequence 1:NP_650528.1 Gene:CG6126 / 41967 FlyBaseID:FBgn0038407 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001286807.1 Gene:CG4324 / 37830 FlyBaseID:FBgn0034956 Length:478 Species:Drosophila melanogaster


Alignment Length:416 Identity:98/416 - (23%)
Similarity:173/416 - (41%) Gaps:58/416 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 DWNFVCDRRWMGAIVQTVFMLGVFTGAVTLGGLADKVGRKTVFCWSALFQLIIGVGVAFIPEYFS 185
            :||..   ::..|.|.||..||:...:.....|:::.|||:......:..::..:..:..|.|..
  Fly    86 EWNVT---KFQQASVTTVVFLGMMLSSSFWTQLSNRYGRKSALTLFGVLLVLYSILSSVAPSYAW 147

  Fly   186 FMVARYLLGIVGSA-GAYICGFVLTMELVGPTKRT-----------VCGITFQAVFAGGIMLVAG 238
            .:..|   |:||.| |.......|..|.: |||..           ..|..|:.|.|..:....|
  Fly   148 LLTLR---GLVGFAIGCVPQSVTLYAEFL-PTKHKGKCVVLMDCFWALGACFEVVLALVVYPYYG 208

  Fly   239 WGALIPDRQWLQVIYGLHGCLFLGHWWWLDESPRWLWMQGRAAEAVDIVAKGLRINGSGIPVDKE 303
            |..|:.......:|:.:...       ||.||.|:....|...:|:.::.:        |..:.:
  Fly   209 WRGLLALSATPLLIFTILSP-------WLSESARYYSYNGHNDKAIKVLEQ--------IAHNNK 258

  Fly   304 YYVQKAKQQAAAEEKSSAGLSDLFRTPNLRMKTLNVCLCWFANSLVYYGLSLSAGKLY------G 362
            .::...:..|..|...:.....|. :|:|...|:.:...|.|::..||||.|...:|.      .
  Fly   259 RHMLMGRLMADDEPSCAESFRSLL-SPSLYRTTILLWFLWLASAFCYYGLVLVTTELLVARNKES 322

  Fly   363 NP----------YLILFIMGLVEFPSYITIVFVLDRLGRRSITSTLMLGGGLCCIVAAYIAQGST 417
            :|          ::.|..:.|.|||..:..:.|:...|::.......|...||.:|...:....:
  Fly   323 HPNECVTFMTSDFMDLLWITLSEFPGILLTIKVVKLFGKKKTIVLQYLALVLCTLVLMSVESRFS 387

  Fly   418 TSTAVVMAGKLLIAGSFAVIYNYSAELFPTVVRNSAMGLGSMCARLSGALTPLI--TLLDSFDPK 480
            ||..:.:| :..|:|.|..||.|:.|::|..:|:..:...|:.|||...|||.:  .|:||  .:
  Fly   388 TSVTLFIA-RGTISGIFQAIYVYTPEIYPAALRSVGVSGCSVLARLGAMLTPFVAQVLMDS--SR 449

  Fly   481 IPAV-LFGVVALISGFWVMFLP-ETM 504
            |.|: .:.:|.|::....:||| ||:
  Fly   450 IQAMSTYAIVGLLASIACVFLPRETV 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6126NP_650528.1 2A0119 15..510 CDD:273328 98/416 (24%)
MFS 130..501 CDD:119392 92/401 (23%)
CG4324NP_001286807.1 2A0119 10..476 CDD:273328 98/416 (24%)
MFS 60..471 CDD:119392 94/410 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1933
SonicParanoid 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.