DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6126 and CG33233

DIOPT Version :9

Sequence 1:NP_650528.1 Gene:CG6126 / 41967 FlyBaseID:FBgn0038407 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster


Alignment Length:435 Identity:84/435 - (19%)
Similarity:146/435 - (33%) Gaps:158/435 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 GVFTGAVTLGGLADKVGRKTVFCWSALFQLIIGVGVAFIPEYFSFMVARYLLGIVGSAGAYI-CG 205
            |:....:.:|.|||:.|||.|...:.:..|...|..|.:|:.:|..|.|.::|...||.|.: .|
  Fly    68 GMVASGLFIGFLADRYGRKFVIRLALVGALSFSVISALMPDLYSLSVIRIIVGTFLSAVASLQVG 132

  Fly   206 FV----------LTMELVGPTKRTV---CGITFQAV-------------------FAGGIMLVAG 238
            |:          :|:.:...::...   |.:...|:                   |.....::.|
  Fly   133 FLGEFHAIKWRPITVAICSQSQGLALIYCPLVAMAILPNNFNVDLSSSYNLRVWRFLMMFFMIPG 197

  Fly   239 WGALIPDRQWLQVIYGLHGCLFLGHWWWLDESPRWLWMQGRAAEAVDIVAKGLRINGSGIPVDKE 303
            |.||:          |:  ||       :.|:|.:|....|..:|:..:....|:|         
  Fly   198 WLALV----------GI--CL-------VPETPHFLMSVNRPDKALLALKWICRMN--------- 234

  Fly   304 YYVQKAKQQ----AAAEEKSSAGLSDLFRTPNLRMKTLNVCLCWFANSLVYYGLSLSAGKLYGNP 364
                :.|.:    ..:|||||....:.|      .||:     |:...|           |:..|
  Fly   235 ----RKKWEDVDITLSEEKSSTNDQEGF------WKTV-----WYEYKL-----------LFSKP 273

  Fly   365 -----YLILFIMGLVEFPS-----YITIVFVLDRLGRRSITSTL--------------------- 398
                 ::.||::..:.|.|     :..::..:|..|...:...:                     
  Fly   274 HVFKFFICLFLIFGIFFTSIGLGIWFPVIRNMDNSGSNRLCDLVNNNPTFINHEADDTNGTDSES 338

  Fly   399 -------------------MLGGGLCCIVAAYIAQGSTTSTAVVMAGKLLIAGSFAVIYNYSAEL 444
                               .:|   |.|:|:.:....|..  .|:|..:||:....:..|...: 
  Fly   339 PKCNDEMTNLIDPVYYGFTYIG---CFILASVLVHWMTRK--YVIALHILISMILGISLNIMKQ- 397

  Fly   445 FPTVVRNSAMGLGSMCARLSGALTPLIT--LLDSFDPKIPAVLFG 487
             ||||    :....:...|.|.|.||.|  |:|.    :|..|.|
  Fly   398 -PTVV----LIFFVLMMVLPGVLIPLATSVLVDC----LPVNLRG 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6126NP_650528.1 2A0119 15..510 CDD:273328 84/435 (19%)
MFS 130..501 CDD:119392 84/435 (19%)
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 84/435 (19%)
MFS 23..>208 CDD:119392 33/158 (21%)
MFS 354..>482 CDD:304372 25/95 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.