DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6126 and T05A1.5

DIOPT Version :9

Sequence 1:NP_650528.1 Gene:CG6126 / 41967 FlyBaseID:FBgn0038407 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001366751.1 Gene:T05A1.5 / 188077 WormBaseID:WBGene00011456 Length:359 Species:Caenorhabditis elegans


Alignment Length:329 Identity:69/329 - (20%)
Similarity:114/329 - (34%) Gaps:94/329 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LEDLMGKLGEFGKYQFLQFFLQVLSGLTAGMHMLSLVTVAAVPEHRCFIEGVDNSSLSVTPWNSS 71
            :|||:.::|.:..|...         :|..|..|.|                    |||.|..|.
 Worm    69 VEDLLDQIGIWHPYPLF---------ITFSMAFLWL--------------------LSVMPTMSP 104

  Fly    72 AILAAIPLKPNGELESCLMFDPSSPGTNTTINCERYVYDTTYYKTSRTIDWNFVCDRRWMGAIVQ 136
            :.:|                 ||||  .|..||........:..|...||         .|.:..
 Worm   105 SYMA-----------------PSSP--CTLDNCSFVTVQNEFNITKTLID---------PGEMTS 141

  Fly   137 TVFMLGVFTGAVTLGGL----ADKVGRKTVFCWSALFQLIIGVGVAFIPEYFSFMVARYLLGIVG 197
            ::|.||  .|  .||.:    ||::||:.|...|.....:.|:|.|:.|.:...::.|:..|...
 Worm   142 SIFFLG--NG--ILGQIYAVAADRIGRRPVLIASLFISGLSGIGAAYAPTFEIMLIGRFFQGSCF 202

  Fly   198 SAGAYICGFVLTMELVGPTKRTVCGITFQAVFAGGIMLVAGWGALIPDRQWLQ------------ 250
            :|...| .:|:..|.:..:......:.|      |:..|.|:.::.|...:..            
 Worm   203 TALTMI-NWVMCCESISFSGHGYASVLF------GLCWVIGYCSVSPLAMYFSTWRYVQLATSVP 260

  Fly   251 -VIYGL-------HGCLFLGHWWWLDESPRWLWMQGRAA-EAVDIVAKGLRINGSGIPVDKEYYV 306
             |::|:       ....||......|:..:|:.|..|.. |.:|..|..: ::.|....|.|..:
 Worm   261 CVLFGILMMFTLPESFSFLVAKRKRDDLVKWIEMASRVGNEEIDYDADQI-VDMSSREEDNESLL 324

  Fly   307 QKAK 310
            |..|
 Worm   325 QTLK 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6126NP_650528.1 2A0119 15..510 CDD:273328 66/321 (21%)
MFS 130..501 CDD:119392 44/206 (21%)
T05A1.5NP_001366751.1 MFS 117..>271 CDD:421695 35/173 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D386678at33208
OrthoFinder 1 1.000 - - FOG0000012
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.