DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bin1 and SAP18

DIOPT Version :9

Sequence 1:NP_001303440.1 Gene:Bin1 / 41965 FlyBaseID:FBgn0024491 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_566050.1 Gene:SAP18 / 819172 AraportID:AT2G45640 Length:152 Species:Arabidopsis thaliana


Alignment Length:120 Identity:57/120 - (47%)
Similarity:83/120 - (69%) Gaps:4/120 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IDREKTCPMLLRVFCSTGRHHSVSEY-MFGNVPTNELQIYTWQDATLHELTSLVRDVNPDTRKKG 81
            :|||||||:|||||..:|.||:..:| :.|..|.:|:|||||:||:|.|||.||::|:...|::.
plant    33 VDREKTCPLLLRVFTKSGGHHTSEDYAVRGKEPKDEVQIYTWKDASLRELTDLVKEVSVAARRRN 97

  Fly    82 TYFDFAVVYPNFRSNHFQMREIGVTCT--GQKGIDDNKTLAQAKFSIGDFLDISI 134
            ....||.||||.:.. :.:||:|.|..  .:|..||:|||::..|.|||:||::|
plant    98 ARLSFAFVYPNNKGG-YNVREVGETMAYPNRKQPDDSKTLSELPFEIGDYLDVAI 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bin1NP_001303440.1 SAP18 22..134 CDD:284018 53/114 (46%)
SAP18NP_566050.1 SAP18 32..151 CDD:399479 56/118 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 115 1.000 Domainoid score I1996
eggNOG 1 0.900 - - E1_KOG3391
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4289
Inparanoid 1 1.050 115 1.000 Inparanoid score I2026
OMA 1 1.010 - - QHG56119
OrthoDB 1 1.010 - - D1622057at2759
OrthoFinder 1 1.000 - - FOG0006494
OrthoInspector 1 1.000 - - oto3928
orthoMCL 1 0.900 - - OOG6_103126
Panther 1 1.100 - - LDO PTHR13082
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4737
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.