DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bin1 and RGD1561590

DIOPT Version :9

Sequence 1:NP_001303440.1 Gene:Bin1 / 41965 FlyBaseID:FBgn0024491 Length:150 Species:Drosophila melanogaster
Sequence 2:XP_002727857.1 Gene:RGD1561590 / 498002 RGDID:1561590 Length:172 Species:Rattus norvegicus


Alignment Length:151 Identity:87/151 - (57%)
Similarity:115/151 - (76%) Gaps:4/151 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VESMIVEE---KTQVKQIDREKTCPMLLRVF-CSTGRHHSVSEYMFGNVPTNELQIYTWQDATLH 64
            |||.:.:|   |...|.||||||||:||||| .:.||||.:.|:..||||::|||||||.||||.
  Rat    22 VESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLK 86

  Fly    65 ELTSLVRDVNPDTRKKGTYFDFAVVYPNFRSNHFQMREIGVTCTGQKGIDDNKTLAQAKFSIGDF 129
            ||||||::|.|:.|||||:|:||:|:.:.:...::::|||.|.:|:||.||:.||...||.|||:
  Rat    87 ELTSLVKEVYPEARKKGTHFNFAIVFMDLKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDY 151

  Fly   130 LDISITPPNRLPPTARRQRPY 150
            |||:||||||.||::.|.|||
  Rat   152 LDIAITPPNRAPPSSGRMRPY 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bin1NP_001303440.1 SAP18 22..134 CDD:284018 65/112 (58%)
RGD1561590XP_002727857.1 SAP18 38..156 CDD:399479 69/117 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337252
Domainoid 1 1.000 149 1.000 Domainoid score I4322
eggNOG 1 0.900 - - E1_KOG3391
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4289
Inparanoid 1 1.050 180 1.000 Inparanoid score I3903
OMA 1 1.010 - - QHG56119
OrthoDB 1 1.010 - - D1622057at2759
OrthoFinder 1 1.000 - - FOG0006494
OrthoInspector 1 1.000 - - oto97819
orthoMCL 1 0.900 - - OOG6_103126
Panther 1 1.100 - - LDO PTHR13082
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4737
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.