DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bin1 and sap18

DIOPT Version :9

Sequence 1:NP_001303440.1 Gene:Bin1 / 41965 FlyBaseID:FBgn0024491 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_957014.1 Gene:sap18 / 393693 ZFINID:ZDB-GENE-040426-1679 Length:153 Species:Danio rerio


Alignment Length:151 Identity:87/151 - (57%)
Similarity:112/151 - (74%) Gaps:4/151 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VESMIVEE---KTQVKQIDREKTCPMLLRVF-CSTGRHHSVSEYMFGNVPTNELQIYTWQDATLH 64
            |||.:.:|   |...|.:|||||||:||||| .:.||||.:.|:..||||::|||||||.||||.
Zfish     3 VESRVTQEEIKKEPTKPVDREKTCPLLLRVFTTNNGRHHRMDEFARGNVPSSELQIYTWMDATLK 67

  Fly    65 ELTSLVRDVNPDTRKKGTYFDFAVVYPNFRSNHFQMREIGVTCTGQKGIDDNKTLAQAKFSIGDF 129
            ||||||::|.|:.|||||:|.||:|||:.:...::::|||.|.:|:||.||:.||....|.|||:
Zfish    68 ELTSLVKEVYPEARKKGTHFGFAIVYPDPKRQIYRVKEIGNTVSGRKGADDSMTLQSQSFQIGDY 132

  Fly   130 LDISITPPNRLPPTARRQRPY 150
            |||:||||||.||...|.|||
Zfish   133 LDIAITPPNRAPPLQGRMRPY 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bin1NP_001303440.1 SAP18 22..134 CDD:284018 66/112 (59%)
sap18NP_957014.1 SAP18 24..137 CDD:284018 66/112 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576375
Domainoid 1 1.000 150 1.000 Domainoid score I4367
eggNOG 1 0.900 - - E1_KOG3391
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4289
Inparanoid 1 1.050 180 1.000 Inparanoid score I3994
OMA 1 1.010 - - QHG56119
OrthoDB 1 1.010 - - D1622057at2759
OrthoFinder 1 1.000 - - FOG0006494
OrthoInspector 1 1.000 - - oto41301
orthoMCL 1 0.900 - - OOG6_103126
Panther 1 1.100 - - LDO PTHR13082
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2783
SonicParanoid 1 1.000 - - X4737
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.