DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bin1 and SPCC126.13c

DIOPT Version :9

Sequence 1:NP_001303440.1 Gene:Bin1 / 41965 FlyBaseID:FBgn0024491 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_588456.1 Gene:SPCC126.13c / 2539066 PomBaseID:SPCC126.13c Length:145 Species:Schizosaccharomyces pombe


Alignment Length:136 Identity:32/136 - (23%)
Similarity:59/136 - (43%) Gaps:11/136 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IVEEKTQVKQIDREK----TCPMLLRVFCSTGRHHSVSEYMFGNVPTNELQIYTWQDATLHELTS 68
            |.|.::|..::.:.:    .||.|:.|:......:.|.:.....:|:  :|:|.|...||:||..
pombe     3 IRESRSQSPELSQSEDAVGPCPFLISVYHQFQTKNHVLDIFEDVIPS--IQVYGWLTMTLYELGV 65

  Fly    69 LVRDV----NPDTRKKGTYFDFAVVYPNFRSNHFQMREIGVTCT-GQKGIDDNKTLAQAKFSIGD 128
            |:.|.    |.:||..........::.:...:....|::|..|. ..|....||.|.:.....||
pombe    66 LIADQLLLNNEETRHSEWSLQIRTIFYDKYKDRPIARDLGTVCLHNPKLFQGNKLLKRTGIKCGD 130

  Fly   129 FLDISI 134
            .:|::|
pombe   131 KIDVTI 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bin1NP_001303440.1 SAP18 22..134 CDD:284018 28/120 (23%)
SPCC126.13cNP_588456.1 SAP18 23..136 CDD:284018 28/114 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3391
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 41 1.000 Inparanoid score I2093
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103126
Panther 1 1.100 - - LDO PTHR13082
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.