DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8927 and Cpr65Ec

DIOPT Version :10

Sequence 1:NP_650527.2 Gene:CG8927 / 41964 FlyBaseID:FBgn0038405 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_648077.1 Gene:Cpr65Ec / 38775 FlyBaseID:FBgn0035737 Length:127 Species:Drosophila melanogaster


Alignment Length:53 Identity:14/53 - (26%)
Similarity:24/53 - (45%) Gaps:1/53 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 RKWREE-NEDGSITWGYENDDGSFKEELIGTDCITKGTYGYVDPDGNKREYHY 314
            |:::.: .||||..:.|:..:|...:|.........|:..|..|||...:..|
  Fly    29 REYKSDLKEDGSYAYQYQTSNGIAGQESGVGGYYASGSNAYYAPDGQLIQLTY 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8927NP_650527.2 Chitin_bind_4 277..336 CDD:459790 9/38 (24%)
Cpr65EcNP_648077.1 Chitin_bind_4 41..88 CDD:459790 9/41 (22%)

Return to query results.
Submit another query.