DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8927 and Cpr49Ae

DIOPT Version :9

Sequence 1:NP_650527.2 Gene:CG8927 / 41964 FlyBaseID:FBgn0038405 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_610774.3 Gene:Cpr49Ae / 36351 FlyBaseID:FBgn0033728 Length:134 Species:Drosophila melanogaster


Alignment Length:96 Identity:24/96 - (25%)
Similarity:35/96 - (36%) Gaps:27/96 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 QRRRQPVSQTIRKWREENEDGSITWGYENDDGSFKEELIGT-----------DCITKGTYGYVDP 305
            |:..:|:: .|.:......|||..:.||..:| .|.|..||           ..|.:|:..|..|
  Fly    22 QKAEEPIA-IISQESNIEPDGSYNYAYETANG-IKAEETGTLKKATSPDSSDVIIARGSVSYTSP 84

  Fly   306 DGNKREYHYETGIKCDPNNRNNEEELQENGF 336
            :||....:|...              .||||
  Fly    85 EGNLITLNYSAD--------------DENGF 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8927NP_650527.2 Chitin_bind_4 276..336 CDD:278791 16/70 (23%)
Cpr49AeNP_610774.3 Chitin_bind_4 43..101 CDD:278791 16/72 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.