DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8927 and Cpr47Ee

DIOPT Version :9

Sequence 1:NP_650527.2 Gene:CG8927 / 41964 FlyBaseID:FBgn0038405 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster


Alignment Length:200 Identity:49/200 - (24%)
Similarity:76/200 - (38%) Gaps:56/200 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 RPESPPPQPM-------ARPRPKPVQPR--------------PIIDQNQLQDDHV--DQQQQRRR 255
            ||:.||.||:       .|.:|.|||.:              |.:....||:.:.  :|.||:..
  Fly    40 RPQVPPLQPLQQQANPFQRRQPNPVQGQGLFPGQRNPLNPLAPPLTGAALQNPYTRYNQYQQQNY 104

  Fly   256 QPVSQTIRKWREENEDGSITWGYENDDGS------FKEEL---IGTDC-ITKGTYGYVDPDGNKR 310
            .|::   ....|.|.|||.::||.:.||:      :.:.|   .|.:. :.:|:|.|..|:|...
  Fly   105 VPIT---AYQNELNLDGSFSYGYSSADGTTAQAQGYVKNLGYGEGVEAQVIQGSYSYTSPEGTPI 166

  Fly   311 EYHY----------ETGIKCDPNNRNNEEELQENGFVNYEENRAVLPNGLEIDMTQLGKKKSKRP 365
            ...|          .|||...|......:..|: |.:|        || |....|...:.....|
  Fly   167 TVRYIADENGFRAEGTGIPSSPQYFAGAQPYQQ-GLLN--------PN-LNPYQTPFRQLPPPLP 221

  Fly   366 NGFYR 370
            |..:|
  Fly   222 NAPFR 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8927NP_650527.2 Chitin_bind_4 276..336 CDD:278791 17/79 (22%)
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:278791 12/56 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.