DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8927 and Cpr47Ed

DIOPT Version :10

Sequence 1:NP_650527.2 Gene:CG8927 / 41964 FlyBaseID:FBgn0038405 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_610658.1 Gene:Cpr47Ed / 36192 FlyBaseID:FBgn0033601 Length:127 Species:Drosophila melanogaster


Alignment Length:90 Identity:21/90 - (23%)
Similarity:39/90 - (43%) Gaps:27/90 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 PVSQTIRKWREENEDGSITWGYENDDGSFKEEL--IGTDCIT-------KGTYGYVDPDGNKREY 312
            |:.:::   .|:...||..:.:|:.||:::|||  :.:|..|       .|.|.|::..|.:.|.
  Fly    29 PILKSV---TEQLSSGSYLFSFESADGTYREELGIVSSDSKTSDDDLEVSGIYRYINDWGQEVEV 90

  Fly   313 HYETGIKCDPNNRNNEEELQENGFV 337
            .|..               .:|||:
  Fly    91 RYTA---------------DKNGFL 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8927NP_650527.2 Chitin_bind_4 277..336 CDD:459790 15/67 (22%)
Cpr47EdNP_610658.1 Chitin_bind_4 43..99 CDD:459790 15/70 (21%)

Return to query results.
Submit another query.