DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8927 and Cpr47Ea

DIOPT Version :10

Sequence 1:NP_650527.2 Gene:CG8927 / 41964 FlyBaseID:FBgn0038405 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_610654.1 Gene:Cpr47Ea / 36188 FlyBaseID:FBgn0033597 Length:135 Species:Drosophila melanogaster


Alignment Length:47 Identity:15/47 - (31%)
Similarity:22/47 - (46%) Gaps:8/47 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 NEDGSITWGYENDDGSFKEEL-----IGTDC---ITKGTYGYVDPDG 307
            |.|||..:.||..:|...:|.     .|:..   :.:|:|.|..|||
  Fly    51 NPDGSYQYNYETSNGIRADEAGYLKNPGSQIEAQVMQGSYSYTGPDG 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8927NP_650527.2 Chitin_bind_4 277..336 CDD:459790 11/39 (28%)
Cpr47EaNP_610654.1 Chitin_bind_4 56..111 CDD:459790 11/42 (26%)

Return to query results.
Submit another query.