DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8927 and Cpr11B

DIOPT Version :10

Sequence 1:NP_650527.2 Gene:CG8927 / 41964 FlyBaseID:FBgn0038405 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_572807.1 Gene:Cpr11B / 32203 FlyBaseID:FBgn0030398 Length:197 Species:Drosophila melanogaster


Alignment Length:130 Identity:25/130 - (19%)
Similarity:45/130 - (34%) Gaps:33/130 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 QRRRQPVSQTIRKWREENEDGSITWGYENDDGSFKEEL-----------IGTDCITKGTYGYVDP 305
            ||::||....:|.....:.:|:..:|::..:|..::|.           :|    .:|:|.|...
  Fly    63 QRQQQPQIPIVRSDYNSDANGNYNFGFDTGNGIHRDETGEFRGGWPHGSLG----VQGSYSYTGD 123

  Fly   306 DGNKREYHYETGIKCDPNNRNNEEELQENGFVNYEENRAVLPNGLEIDMTQLGKKKSKRPNGFYR 370
            ||.:...:|..               .:|||   ....|.||....:.....|:.........||
  Fly   124 DGKQYTVNYTA---------------DKNGF---HAEGAHLPVSPSVPAAPAGRSSYGAGGSGYR 170

  Fly   371  370
              Fly   171  170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8927NP_650527.2 Chitin_bind_4 277..336 CDD:459790 11/69 (16%)
Cpr11BNP_572807.1 Chitin_bind_4 85..139 CDD:459790 11/72 (15%)

Return to query results.
Submit another query.