DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8927 and Cpr11A

DIOPT Version :10

Sequence 1:NP_650527.2 Gene:CG8927 / 41964 FlyBaseID:FBgn0038405 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_572803.1 Gene:Cpr11A / 32198 FlyBaseID:FBgn0030394 Length:270 Species:Drosophila melanogaster


Alignment Length:122 Identity:26/122 - (21%)
Similarity:37/122 - (30%) Gaps:47/122 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 PPPQPMARPRPKPVQPRPIIDQNQLQDDHVDQQQQRRRQPVSQTIRKWREENEDGSITW-GYEND 281
            |.|||:|     ....|..:|.:.|..:      :.|.|.:.||:..  ::...|.:.. |...|
  Fly   135 PEPQPLA-----SAGQRQTVDPSSLLGN------KNRFQFLQQTLDS--DQGSQGPLRGSGQSGD 186

  Fly   282 DGSFKEELIGTDCITKGTYGYVDPDGNKREYHYETGIKCDPNNRNNEEELQENGFVN 338
            |                 |.|..|.||...|....|                ||:.|
  Fly   187 D-----------------YSYTSPYGNGNAYGNGVG----------------NGYGN 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8927NP_650527.2 Chitin_bind_4 277..336 CDD:459790 11/58 (19%)
Cpr11ANP_572803.1 Chitin_bind_4 73..124 CDD:459790
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.