DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6006 and GIT1

DIOPT Version :9

Sequence 1:NP_001097812.1 Gene:CG6006 / 41962 FlyBaseID:FBgn0063649 Length:603 Species:Drosophila melanogaster
Sequence 2:NP_010022.1 Gene:GIT1 / 850462 SGDID:S000000695 Length:518 Species:Saccharomyces cerevisiae


Alignment Length:459 Identity:93/459 - (20%)
Similarity:153/459 - (33%) Gaps:136/459 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 NETTLPSDWK-------TPAEMDKKLVACEKWEYETNDNVGNTWTSQWDLVCE------------ 210
            ||.|.|...|       |..|..||    :||:     |:.....|.:.|:.:            
Yeast    15 NENTNPRIIKYDAERRATRTETSKK----DKWK-----NIVTIIASGFALISDGYVNGSMSMLNK 70

  Fly   211 ---------------KEHLKNVAEMFFLLGVATGGIISGYLSDKFGRKTMLFISAVLQTIFGLWL 260
                           ...:.|.|    |:|:..|....|..:|.:.||:.:.::..:..|...  
Yeast    71 VFVMEYGKKNYSSKVSTRVSNAA----LVGIIFGQFFMGIAADYYSRKSCILVATAILVIGSA-- 129

  Fly   261 YICSSFE------LYLTLRALLGLVSVSV-------TYSGLILAIEYVDGKWRTIAGMYNLFPLP 312
             :|::..      ::..|..:.|||.:.|       |.|....|.||...|...|..|....||.
Yeast   130 -LCAASHGTTVPGMFWMLTVMRGLVGIGVGAEYPTSTLSANESANEYTTTKRGGILVMVTNLPLA 193

  Fly   313 -----------ISYMIISGLAYLTQDYQRLQLCIGIPGIFLCFLWFVVPESPRWLLVKGRIDEVR 366
                       |.|.|.||..:| :...|....||      || |.:.....||......:.|..
Yeast   194 FGGPFATIIFLIVYKICSGTKHL-EAIWRTVFAIG------CF-WPLSVFYFRWKTATTEVYEKG 250

  Fly   367 RIIEAAAKFNGRQLPADYQLTPPTQESSTQDVTYLFRSSYLRR-ISICFFCIWFTMNLVYYGIIL 430
            ||        .|.:|                 .:|....|.:| :..|  ..||..:.|.:...:
Yeast   251 RI--------KRNIP-----------------YFLALKFYWKRLLGTC--GTWFMYDFVTFPNGI 288

  Fly   431 NMSSFGGNVYLN----------SALAGLVEIPAIAVAMYIITKVGKKWLFC---ATLICAGVACC 482
            ..|:...:|..:          :.|.|::.:..:.:..|:..::|:|:...   :..|..|:...
Yeast   289 FSSTIISSVIKDQNDLVKVAEWNLLLGVLAVLGVPIGAYLSDRIGRKYTLMFGFSGYIIFGLIIG 353

  Fly   483 CAAITEGHADLLWLKIT--FLMMGKFTISAGNT----IMPVYTAELYPTPIRNVGVGACNVAAGL 541
            ||      .|.| .|||  |::...|....||.    ::.|.::|...|.:|.|..|...|...:
Yeast   354 CA------YDQL-KKITPLFIIFYAFMNMLGNAGPGDMLGVISSEASATAVRGVFYGLSAVTGKI 411

  Fly   542 ALIL 545
            ..::
Yeast   412 GSVV 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6006NP_001097812.1 2A0119 90..581 CDD:273328 93/459 (20%)
MFS 222..579 CDD:119392 77/368 (21%)
GIT1NP_010022.1 MFS_PhT 48..454 CDD:340922 81/417 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.