DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6006 and CG12783

DIOPT Version :9

Sequence 1:NP_001097812.1 Gene:CG6006 / 41962 FlyBaseID:FBgn0063649 Length:603 Species:Drosophila melanogaster
Sequence 2:NP_001262644.2 Gene:CG12783 / 42019 FlyBaseID:FBgn0038448 Length:493 Species:Drosophila melanogaster


Alignment Length:472 Identity:95/472 - (20%)
Similarity:161/472 - (34%) Gaps:146/472 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 VCEKEHLKNVAEMFFLLGVATGGIIS-----GYLSDKFGRKTMLFISAVLQTIFGLWLYICSSFE 267
            ||:..  .|.|::..|......|||.     ||::||.||:..|..:..:..:..|......:|.
  Fly    46 VCDLR--MNEAQLASLTAAGFMGIICSSYFWGYITDKKGRRWTLLRTITISNLCSLASMFTVTFT 108

  Fly   268 LYLTLRAL-----LGLVSVSVTY-----SGLILAIEYVDGKWRTIAGMYNLF--------PLPIS 314
            .:..:|.:     .|...|:.||     |..|:.        |:|..:| :|        |...:
  Fly   109 GFFVMRFITCIFVAGPSFVAATYLSEFCSHRIMV--------RSITHLY-MFTGFAMISCPAWAT 164

  Fly   315 YMIISGL--------AYLTQDYQRLQLCIGI-PGIFLCFLWFVVPESPRWLLVKGRIDEVRRIIE 370
            ..:.|||        ..||....|:..|:.| ||:....|..::||||::||:   |.|.:|.::
  Fly   165 LFLSSGLIEFEEKLVGSLTLRPWRVLGCLYILPGVVAFLLLLLLPESPKFLLM---IGETKRGLD 226

  Fly   371 A----AAKFNGRQLPAD-------YQLTPPTQ---------ESSTQDVTYLFRSSYLRRISICFF 415
            .    :.|..||.|..|       ||.....:         .|...|...|.|..|....: |..
  Fly   227 TMEWISRKNTGRTLSEDQMKRLLAYQEHVQVKRRKEHQNFFRSMLDDAMPLVRKPYGGYFT-CVC 290

  Fly   416 CIWFTMNLVYYGI-------------------------------------------ILNMSSFGG 437
            .:.|.:.|:.:|:                                           ::...||.|
  Fly   291 MVMFVLGLLTHGLGIWYTAMRNRCNMRQGNTNGMTFCQVLFVPETGPFIETESDLDVVCSDSFKG 355

  Fly   438 NVYLNSALAGLVEIPAIAVAMYIITKVGKKWLFCATLICAGVACCCAAITEGHADLLWLKITFLM 502
              :.:|.:.|.|.:....::...:..|.||.:|..:|:.:............|    .|::..|:
  Fly   356 --FNDSFVLGFVYVVLYNISWASLFCVHKKVMFVFSLVASSTFGFLLIFATNH----MLQLFSLV 414

  Fly   503 MGKFTISAGNTIMPVYTAEL---YPTPIRNVGV------GACNVAAG----------------LA 542
               |.|:....|:.:....|   .||.:|...:      ..|..|.|                ||
  Fly   415 ---FLIAFPGIIIGLLGGSLLVFVPTYLRGKALCISLMWCRCGAAFGAMLVGSKIQYNCELFLLA 476

  Fly   543 LILTPYLSLLNKIEGHL 559
            :.:.|.::..  :||:|
  Fly   477 ISILPLIAAC--MEGYL 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6006NP_001097812.1 2A0119 90..581 CDD:273328 95/472 (20%)
MFS 222..579 CDD:119392 91/458 (20%)
CG12783NP_001262644.2 synapt_SV2 <2..>310 CDD:130366 65/278 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.