DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6006 and CG33233

DIOPT Version :9

Sequence 1:NP_001097812.1 Gene:CG6006 / 41962 FlyBaseID:FBgn0063649 Length:603 Species:Drosophila melanogaster
Sequence 2:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster


Alignment Length:307 Identity:73/307 - (23%)
Similarity:129/307 - (42%) Gaps:89/307 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 LVACEKWEYETNDNVGNTWTSQWDLVCEKEHLKNVAEMFFLLGVATGGIISGYLSDKFGRKTML- 246
            ||.....|::|:..             ||..|.|    ..|.|:...|:..|:|:|::|||.:: 
  Fly    43 LVVLTSCEFDTSPK-------------EKTLLAN----SLLGGMVASGLFIGFLADRYGRKFVIR 90

  Fly   247 ----------FISAVLQTIFGLWLYICSSFELYLTLRALLG-----LVSVSVTYSGLILAIEYVD 296
                      .|||::..::.|           ..:|.::|     :.|:.|.:.|...||    
  Fly    91 LALVGALSFSVISALMPDLYSL-----------SVIRIIVGTFLSAVASLQVGFLGEFHAI---- 140

  Fly   297 GKWRTIA--------GMYNLF-P------LPISYMIISGLAYLTQDYQRLQLCIGIPG----IFL 342
             |||.|.        |:..:: |      ||.::.:....:|..:.::.|.:...|||    :.:
  Fly   141 -KWRPITVAICSQSQGLALIYCPLVAMAILPNNFNVDLSSSYNLRVWRFLMMFFMIPGWLALVGI 204

  Fly   343 CFLWFVVPESPRWLLVKGRIDEVRRIIEAAAKFNGRQLPADYQLTPPTQESSTQD-------VTY 400
            |    :|||:|.:|:...|.|:....::...:.| |:...|..:|...::|||.|       |.|
  Fly   205 C----LVPETPHFLMSVNRPDKALLALKWICRMN-RKKWEDVDITLSEEKSSTNDQEGFWKTVWY 264

  Fly   401 ----LFRSSYLRRISICFFC---IWFT-MNL-VYYGIILNMSSFGGN 438
                ||...::.:..||.|.   |:|| :.| :::.:|.||.:.|.|
  Fly   265 EYKLLFSKPHVFKFFICLFLIFGIFFTSIGLGIWFPVIRNMDNSGSN 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6006NP_001097812.1 2A0119 90..581 CDD:273328 73/307 (24%)
MFS 222..579 CDD:119392 65/268 (24%)
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 73/307 (24%)
MFS 23..>208 CDD:119392 42/201 (21%)
MFS 354..>482 CDD:304372
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.