DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2 and HAND2

DIOPT Version :9

Sequence 1:NP_001287359.1 Gene:Fer2 / 41961 FlyBaseID:FBgn0038402 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_068808.1 Gene:HAND2 / 9464 HGNCID:4808 Length:217 Species:Homo sapiens


Alignment Length:144 Identity:49/144 - (34%)
Similarity:66/144 - (45%) Gaps:38/144 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 SPSASSSGGGCGNA--GSATPG----GAGGPNPGYGSVGAATASSYKMQRQAANVRERKRIQRSA 164
            ||..:|...|..::  |...||    |.|||.|             ..:|..||.:||:|.|   
Human    65 SPEYASGAAGLDHSHYGGVPPGAGPPGLGGPRP-------------VKRRGTANRKERRRTQ--- 113

  Fly   165 PTGYTKCSINSAFDELRVHVPTFPYEKRLSKIDTLRLAIAYISLLREVLQTDYDPLTYVEKCLRG 229
                   ||||||.|||..:|..|.:.:||||.|||||.:||:.|.::|..|..         .|
Human   114 -------SINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLAKDDQ---------NG 162

  Fly   230 EIKADRANWNTSDL 243
            |.:|.:|....:|:
Human   163 EAEAFKAEIKKTDV 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2NP_001287359.1 HLH 148..210 CDD:278439 29/61 (48%)
HAND2NP_068808.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..116 16/62 (26%)
bHLH_TS_HAND2 100..161 CDD:381477 32/79 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.