DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2 and TAL1

DIOPT Version :9

Sequence 1:NP_001287359.1 Gene:Fer2 / 41961 FlyBaseID:FBgn0038402 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001274276.1 Gene:TAL1 / 6886 HGNCID:11556 Length:331 Species:Homo sapiens


Alignment Length:226 Identity:60/226 - (26%)
Similarity:83/226 - (36%) Gaps:68/226 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GATGGGGGSGGGGGSSGLRLSSNNLRHIQQHYMQHSGENLLDSSTNPMGVHNS------GGGAPL 102
            ||.||.||...|||.:...|...:....:..:...:.|........|.....|      |.|..:
Human    55 GARGGPGGGPAGGGGAARDLKGRDAATAEARHRVPTTELCRPPGPAPAPAPASVTAELPGDGRMV 119

  Fly   103 MCNSPSASSSGGGCGNAGSATPGGA-----GGP--NPGYGSVGAATA--------------SSYK 146
            ..:.|:.         |..|.||.|     ..|  :.|.|..|...|              |.|:
Human   120 QLSPPAL---------AAPAAPGRALLYSLSQPLASLGSGFFGEPDAFPMFTTNNRVKRRPSPYE 175

  Fly   147 MQ-----------RQAANVRERKRIQRSAPTGYTKCSINSAFDELRVHVPTFPYEKRLSKIDTLR 200
            |:           |...|.|||.|.|          ::|.||.|||..:||.|.:|:|||.:.||
Human   176 MEITDGPHTKVVRRIFTNSRERWRQQ----------NVNGAFAELRKLIPTHPPDKKLSKNEILR 230

  Fly   201 LAIAYISLLREVL-----------QTDYDPL 220
            ||:.||:.|.::|           :|..||:
Human   231 LAMKYINFLAKLLNDQEEEGTQRAKTGKDPV 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2NP_001287359.1 HLH 148..210 CDD:278439 26/72 (36%)
TAL1NP_001274276.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..86 10/30 (33%)
HLH 193..243 CDD:197674 26/59 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..331 3/13 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.