DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2 and NEUROG2

DIOPT Version :9

Sequence 1:NP_001287359.1 Gene:Fer2 / 41961 FlyBaseID:FBgn0038402 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_076924.1 Gene:NEUROG2 / 63973 HGNCID:13805 Length:272 Species:Homo sapiens


Alignment Length:212 Identity:55/212 - (25%)
Similarity:79/212 - (37%) Gaps:71/212 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SSSPPISHL-PFHNFDDDLINDLPSCIYAGQHQGGGATGGGGGSGGGGGSSGLRLSSNNLRHIQQ 73
            |:||.::.| |..:..|:...:.|......:.|.|...|.|...|...|:.|.|           
Human    22 SASPALAALTPLSSSADEEEEEEPGASGGARRQRGAEAGQGARGGVAAGAEGCR----------- 75

  Fly    74 HYMQHSGENLLDSSTNPMG-VHNSGGGAPLMC-NSPSASSSGGGCGNAGSATPGGAGGPNPGYGS 136
                         ....:| ||:        | ..||.:.:                      .|
Human    76 -------------PARLLGLVHD--------CKRRPSRARA----------------------VS 97

  Fly   137 VGAATASSY----KMQRQAANVRERKRIQRSAPTGYTKCSINSAFDELRVHVPTFPYEKRLSKID 197
            .||.||.:.    |.:|..||.|||.|:.          ::|:|.|.||..:||||.:.:|:||:
Human    98 RGAKTAETVQRIKKTRRLKANNRERNRMH----------NLNAALDALREVLPTFPEDAKLTKIE 152

  Fly   198 TLRLAIAYISLLREVLQ 214
            |||.|..||..|.|.|:
Human   153 TLRFAHNYIWALTETLR 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2NP_001287359.1 HLH 148..210 CDD:278439 25/61 (41%)
NEUROG2NP_076924.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..69 9/38 (24%)
bHLH_TS_NGN2_ATOH4 104..172 CDD:381560 29/76 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..264
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.