DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2 and mespba

DIOPT Version :10

Sequence 1:NP_001287359.1 Gene:Fer2 / 41961 FlyBaseID:FBgn0038402 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_571627.1 Gene:mespba / 58070 ZFINID:ZDB-GENE-000406-9 Length:236 Species:Danio rerio


Alignment Length:77 Identity:25/77 - (32%)
Similarity:38/77 - (49%) Gaps:12/77 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 QRQAANVRERKRIQRSAPTGYTKCSINSAFDELRVHVP--TFPYEKRLSKIDTLRLAIAYISLLR 210
            :||.|:.:|:.|::          .:..|...||..:|  ..|..:.|:||:||||.|.|||.|.
Zfish    67 RRQNASEKEKLRMR----------DLTKALHHLRSFLPASVAPVGQTLTKIETLRLTIQYISFLS 121

  Fly   211 EVLQTDYDPLTY 222
            ..|....:.|:|
Zfish   122 SQLGLSEEELSY 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2NP_001287359.1 bHLH_SF 144..216 CDD:469605 23/69 (33%)
mespbaNP_571627.1 bHLH_SF 67..131 CDD:469605 23/73 (32%)

Return to query results.
Submit another query.