DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2 and tcf21

DIOPT Version :9

Sequence 1:NP_001287359.1 Gene:Fer2 / 41961 FlyBaseID:FBgn0038402 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001032770.1 Gene:tcf21 / 558148 ZFINID:ZDB-GENE-051113-88 Length:176 Species:Danio rerio


Alignment Length:268 Identity:60/268 - (22%)
Similarity:89/268 - (33%) Gaps:117/268 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 FHNFDDDLINDLPSCIYAGQHQGGGATGGGGGSGGGGGSSGLRLSSNNLRHIQQHYMQHSGENLL 84
            ||  :.:|::.||..                |||...|:                    |.|:..
Zfish    12 FH--ESELLDGLPKF----------------GSGKDPGT--------------------SNESTE 38

  Fly    85 DSSTNPMGVHNSGGGAPLMCNSPSASSSGGGCGNAGSATPGGAGGPNPGYGSVGAATASSYKMQR 149
            |||       |..|.:...|......|:     |...:.|.|             ......::||
Zfish    39 DSS-------NCEGASVSECTGKRRKSA-----NMRRSAPNG-------------VAQEGKQVQR 78

  Fly   150 QAANVRERKRIQRSAPTGYTKCSINSAFDELRVHVPTFPYEKRLSKIDTLRLAIAYISLLREVLQ 214
            .|||.|||.|::          .::.||..|:..:|..|.:.:|||:||||||.:||:.||::|.
Zfish    79 NAANARERARMR----------VLSKAFSRLKTTLPWVPPDTKLSKLDTLRLASSYIAHLRQILA 133

  Fly   215 TDYDPLTYVEKCLRGEIKADRANWNTSDLTARLSWINWENLGVHPGRRTLLTSLA---------- 269
            .|                                  .:||..:||...|....:|          
Zfish   134 ND----------------------------------KYENGYIHPVNLTWPFMVAGKPENELKEM 164

  Fly   270 LSSEPMCG 277
            |:|..:||
Zfish   165 LNSTRLCG 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2NP_001287359.1 HLH 148..210 CDD:278439 25/61 (41%)
tcf21NP_001032770.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..84 26/134 (19%)
HLH 77..129 CDD:278439 25/61 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.