DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2 and figla

DIOPT Version :9

Sequence 1:NP_001287359.1 Gene:Fer2 / 41961 FlyBaseID:FBgn0038402 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001016342.1 Gene:figla / 549096 XenbaseID:XB-GENE-966403 Length:203 Species:Xenopus tropicalis


Alignment Length:138 Identity:42/138 - (30%)
Similarity:64/138 - (46%) Gaps:37/138 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 QRQAANVRERKRIQRSAPTGYTKCSINSAFDELRVHVPTFPYEKRLSKIDTLRLAIAYISLLREV 212
            :|||||.:||:||:          :|||.|.:|:..||..|.:::.||:|||:.|..||.||.::
 Frog    59 RRQAANAKERERIR----------NINSGFSKLKTIVPLIPKDRKPSKVDTLKAATEYIRLLHDI 113

  Fly   213 LQ----------------TDYDPLTYVEKCLRGEIKAD-RANWNTSDLTARLSWI--------NW 252
            |:                ||....|.:.: .||.|..| |.| ...|:...:.::        .|
 Frog   114 LEETGGFEKVEDLPDIELTDRYAGTLIPE-FRGTIPTDFRIN-PLGDVKGGIPFVIKPKEPVCLW 176

  Fly   253 ENLGVHPG 260
            ...|:.||
 Frog   177 RAAGMFPG 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2NP_001287359.1 HLH 148..210 CDD:278439 26/61 (43%)
figlaNP_001016342.1 HLH 58..115 CDD:238036 27/65 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.