DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2 and Atoh1

DIOPT Version :9

Sequence 1:NP_001287359.1 Gene:Fer2 / 41961 FlyBaseID:FBgn0038402 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001102708.1 Gene:Atoh1 / 500156 RGDID:1565171 Length:351 Species:Rattus norvegicus


Alignment Length:161 Identity:47/161 - (29%)
Similarity:66/161 - (40%) Gaps:44/161 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 YMQHSGENLLDSSTNP------MG--VHNSGGG------APLMCNSPSASSSGG------GCGNA 119
            |:.||.|.....:..|      .|  |..||.|      .|:..........||      ||...
  Rat    78 YLLHSPELGASEAAAPGDEADGQGELVRRSGCGGLSKSPGPVKVREQLCKLKGGVVVDELGCSRQ 142

  Fly   120 GSATPGGAGGPNPGYGSVGAATASSYKMQRQAANVRERKRIQRSAPTGYTKCSINSAFDELRVHV 184
            .:.:.....|..              |.:|.|||.|||:|:.          .:|.|||:||..:
  Rat   143 RAPSSKQVNGVQ--------------KQRRLAANARERRRMH----------GLNHAFDQLRNVI 183

  Fly   185 PTFPYEKRLSKIDTLRLAIAYISLLREVLQT 215
            |:|..:|:|||.:||::|..||:.|.|:|||
  Rat   184 PSFNNDKKLSKYETLQMAQIYINALSELLQT 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2NP_001287359.1 HLH 148..210 CDD:278439 25/61 (41%)
Atoh1NP_001102708.1 HLH 155..213 CDD:238036 28/67 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.