DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2 and Ferd3l

DIOPT Version :9

Sequence 1:NP_001287359.1 Gene:Fer2 / 41961 FlyBaseID:FBgn0038402 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001102450.1 Gene:Ferd3l / 366598 RGDID:1311812 Length:166 Species:Rattus norvegicus


Alignment Length:68 Identity:40/68 - (58%)
Similarity:50/68 - (73%) Gaps:10/68 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 QRQAANVRERKRIQRSAPTGYTKCSINSAFDELRVHVPTFPYEKRLSKIDTLRLAIAYISLLREV 212
            ||||||:|||||:          .::|.|||:||..||||.||||||:|:||||||.|||.:.|:
  Rat   102 QRQAANIRERKRM----------FNLNEAFDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTEL 156

  Fly   213 LQT 215
            ||:
  Rat   157 LQS 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2NP_001287359.1 HLH 148..210 CDD:278439 37/61 (61%)
Ferd3lNP_001102450.1 HLH 102..154 CDD:278439 37/61 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3328
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.