DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2 and Tal1

DIOPT Version :9

Sequence 1:NP_001287359.1 Gene:Fer2 / 41961 FlyBaseID:FBgn0038402 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001101428.2 Gene:Tal1 / 313507 RGDID:1306748 Length:329 Species:Rattus norvegicus


Alignment Length:214 Identity:57/214 - (26%)
Similarity:79/214 - (36%) Gaps:67/214 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GGGATGGGGGSGGGGGSSGLR---LSSNNLRHIQQHYMQHSGENLLDSSTNPMGVHNSGGGAPLM 103
            |..::.|||.:||||.:..|:   ..:...||              ...|..:........||..
  Rat    55 GARSSAGGGPAGGGGAARDLKGRDAVATEARH--------------RVPTTELCRPPGPAPAPAP 105

  Fly   104 CNSPSASSSGGG----CGNAGSATPGGAGG----------PNPGYGSVGAATA------------ 142
            .::| |...|.|    ......|.|.|.|.          .:.|.|..|...|            
  Rat   106 ASAP-AELPGDGRMVQLSPPALAAPAGPGRALLYSLSQPLASLGSGFFGEPDAFPMFTNNNRVKR 169

  Fly   143 --SSYKMQ-----------RQAANVRERKRIQRSAPTGYTKCSINSAFDELRVHVPTFPYEKRLS 194
              |.|:|:           |...|.|||.|.|          ::|.||.|||..:||.|.:|:||
  Rat   170 RPSPYEMEITDGPHTKVVRRIFTNSRERWRQQ----------NVNGAFAELRKLIPTHPPDKKLS 224

  Fly   195 KIDTLRLAIAYISLLREVL 213
            |.:.||||:.||:.|.::|
  Rat   225 KNEILRLAMKYINFLAKLL 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2NP_001287359.1 HLH 148..210 CDD:278439 26/72 (36%)
Tal1NP_001101428.2 bHLH_TS_TAL1 185..249 CDD:381549 28/69 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.