DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2 and ase

DIOPT Version :9

Sequence 1:NP_001287359.1 Gene:Fer2 / 41961 FlyBaseID:FBgn0038402 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster


Alignment Length:129 Identity:38/129 - (29%)
Similarity:52/129 - (40%) Gaps:47/129 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 PSASSSGGGCGNAGSATPGGAGGPNPGYGSVGAATASSYKMQRQAA---NVRERKRIQRSAPTGY 168
            |..|.|....|     |||..|.|.|                 ||.   |.|||.|:::      
  Fly   138 PHKSQSDQSFG-----TPGRKGLPLP-----------------QAVARRNARERNRVKQ------ 174

  Fly   169 TKCSINSAFDELRVHVPTFPYE------------KRLSKIDTLRLAIAYISLLREVLQTDYDPL 220
                :|:.|..||..:|....|            |:|||::|||:|:.||..|.::|..|:.||
  Fly   175 ----VNNGFALLREKIPEEVSEAFEAQGAGRGASKKLSKVETLRMAVEYIRSLEKLLGFDFPPL 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2NP_001287359.1 HLH 148..210 CDD:278439 23/76 (30%)
aseNP_476694.1 HLH <172..224 CDD:278439 16/61 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.