DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2 and sc

DIOPT Version :9

Sequence 1:NP_001287359.1 Gene:Fer2 / 41961 FlyBaseID:FBgn0038402 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster


Alignment Length:272 Identity:61/272 - (22%)
Similarity:103/272 - (37%) Gaps:88/272 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 SGENLLDSSTNPMGVHNSGGGAPLMCNS-------------PSASSSGGGCGN-AGSA------- 122
            :..|...|:|....|.::....|...||             ||....||.... ||:.       
  Fly     3 NNNNTTKSTTMSSSVLSTNETFPTTINSATKIFRYQHIMPAPSPLIPGGNQNQPAGTMPIKTRKY 67

  Fly   123 TPGG---------AGGPNPGYGSVGAATASSYKMQRQAANVRERKRIQRSAPTGYTKCSINSAFD 178
            ||.|         ....:||..........|..:||:  |.|||.|:::          :|::|.
  Fly    68 TPRGMALTRCSESVSSLSPGSSPAPYNVDQSQSVQRR--NARERNRVKQ----------VNNSFA 120

  Fly   179 ELRVHVPTF------------PYEKRLSKIDTLRLAIAYISLLREVLQT--------DYDPLTYV 223
            .||.|:|..            |: |::||:||||:|:.||..|::::..        ..:.:|.:
  Fly   121 RLRQHIPQSIITDLTKGGGRGPH-KKISKVDTLRIAVEYIRRLQDLVDDLNGGSNIGANNAVTQL 184

  Fly   224 EKCLRGEIKADRANWNTSDLTARLSWIN--WEN-LGVHPGRR-----------------TLLTSL 268
            :.||     .:.::.::|..|...|..|  ::| :.|.|.::                 :|.|:|
  Fly   185 QLCL-----DESSSHSSSSSTCSSSGHNTYYQNTISVSPLQQQQQLQRQQFNHQPLTALSLNTNL 244

  Fly   269 ALSSEPMCGAHC 280
            ..:|.|...|.|
  Fly   245 VGTSVPGGDAGC 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2NP_001287359.1 HLH 148..210 CDD:278439 24/73 (33%)
scNP_476803.1 HLH 105..163 CDD:278439 22/68 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.