Sequence 1: | NP_001287359.1 | Gene: | Fer2 / 41961 | FlyBaseID: | FBgn0038402 | Length: | 283 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_998402.1 | Gene: | tal1 / 30766 | ZFINID: | ZDB-GENE-980526-501 | Length: | 324 | Species: | Danio rerio |
Alignment Length: | 202 | Identity: | 60/202 - (29%) |
---|---|---|---|
Similarity: | 80/202 - (39%) | Gaps: | 59/202 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 83 LLDSSTNPMGVHNSGGGAPLMCNSPSASSSGGGCGNAGSATPGGAGGPN-----PGYGSVGAATA 142
Fly 143 SSYKMQRQA-ANVRERKRIQRSAPTGYTKCSINSAFDELRVHVPTFPYEKRLSKIDTLRLAIAYI 206
Fly 207 SLLREVLQTDYDPLTYVEKCLRGEIKADRANWNTSDLTARLSWINWENLGVHPGRRTLLTSLALS 271
Fly 272 SEPMCGA 278 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fer2 | NP_001287359.1 | HLH | 148..210 | CDD:278439 | 26/62 (42%) |
tal1 | NP_998402.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..49 | ||
HLH | 191..241 | CDD:197674 | 26/59 (44%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 276..324 | 3/8 (38%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4029 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |