powered by:
Protein Alignment Fer2 and tcf15
DIOPT Version :9
Sequence 1: | NP_001287359.1 |
Gene: | Fer2 / 41961 |
FlyBaseID: | FBgn0038402 |
Length: | 283 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_571047.1 |
Gene: | tcf15 / 30159 |
ZFINID: | ZDB-GENE-980605-20 |
Length: | 183 |
Species: | Danio rerio |
Alignment Length: | 66 |
Identity: | 34/66 - (51%) |
Similarity: | 42/66 - (63%) |
Gaps: | 10/66 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 148 QRQAANVRERKRIQRSAPTGYTKCSINSAFDELRVHVPTFPYEKRLSKIDTLRLAIAYISLLREV 212
||.|||.|||.|.| |:|:||..||..:||.|.:::||||:|||||.:|||.|..|
Zfish 65 QRNAANARERDRTQ----------SVNTAFTALRTLIPTEPVDRKLSKIETLRLASSYISHLANV 119
Fly 213 L 213
|
Zfish 120 L 120
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Fer2 | NP_001287359.1 |
HLH |
148..210 |
CDD:278439 |
31/61 (51%) |
tcf15 | NP_571047.1 |
HLH |
65..116 |
CDD:278439 |
31/60 (52%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4029 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.