DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2 and Tcf15

DIOPT Version :9

Sequence 1:NP_001287359.1 Gene:Fer2 / 41961 FlyBaseID:FBgn0038402 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001162051.1 Gene:Tcf15 / 296272 RGDID:1308464 Length:195 Species:Rattus norvegicus


Alignment Length:132 Identity:50/132 - (37%)
Similarity:63/132 - (47%) Gaps:21/132 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 PMGVHNSGGGAPLMC------NSPSASSSGGGCGNAGSATPGGAGGPNPGYG--SVGAATASSYK 146
            |:|.|.......|:.      :...||....||.....|   ...||.||.|  :.|.|......
  Rat     8 PVGAHVLYPDVRLLSEDEENRSESDASDQSFGCCEGLEA---ARRGPGPGSGRRASGGAGPVVVV 69

  Fly   147 MQRQAANVRERKRIQRSAPTGYTKCSINSAFDELRVHVPTFPYEKRLSKIDTLRLAIAYISLLRE 211
            .||||||.|||.|.|          |:|:||..||..:||.|.:::||||:|||||.:||:.|..
  Rat    70 RQRQAANARERDRTQ----------SVNTAFTALRTLIPTEPVDRKLSKIETLRLASSYIAHLAN 124

  Fly   212 VL 213
            ||
  Rat   125 VL 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2NP_001287359.1 HLH 148..210 CDD:278439 31/61 (51%)
Tcf15NP_001162051.1 bHLH_TS_TCF15_paraxis 64..129 CDD:381476 34/73 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.