DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2 and Mesp2

DIOPT Version :9

Sequence 1:NP_001287359.1 Gene:Fer2 / 41961 FlyBaseID:FBgn0038402 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001099743.1 Gene:Mesp2 / 293046 RGDID:1305959 Length:368 Species:Rattus norvegicus


Alignment Length:224 Identity:60/224 - (26%)
Similarity:83/224 - (37%) Gaps:81/224 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 YMQHSGENLLDSSTNPMGVHNSGGGAPLMCNSPSASSSGGG--------CGNA-GSATPGGAGGP 130
            :.:||      .||:|....:|.|..|.....|.:.|:|..        ..|| ..|.|..||| 
  Rat    24 WARHS------DSTSPASSSDSSGSCPCYATRPPSQSTGPARSARNTQVAPNAPRRARPAPAGG- 81

  Fly   131 NPGYGSVGAATASSYKMQRQAANVRERKRIQRSAPTGYTKCSINSAFDELRVHVP--TFPYEKRL 193
                             |||:|:.||:.|::          ::..|..|||..:|  ..|..:.|
  Rat    82 -----------------QRQSASEREKLRMR----------TLARALQELRRFLPPSVAPAGQSL 119

  Fly   194 SKIDTLRLAIAYISLLREVLQTDYDPLTYVEKCLRGEIKADRANWNT------------------ 240
            :||:||||||.||..|..:|....|.|.     .|....||.|..:.                  
  Rat   120 TKIETLRLAIRYIGHLSALLGLSEDSLR-----RRRRRSADAAFSHRCPQCPDDSSPSQAQMLGP 179

  Fly   241 ---SDLTARLSW----------INWENLG 256
               ||:::.|||          |:.||||
  Rat   180 SLGSDISSGLSWGCPPACPGPIISPENLG 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2NP_001287359.1 HLH 148..210 CDD:278439 24/63 (38%)
Mesp2NP_001099743.1 HLH 82..135 CDD:278439 24/62 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.