DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2 and Fer1

DIOPT Version :9

Sequence 1:NP_001287359.1 Gene:Fer2 / 41961 FlyBaseID:FBgn0038402 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster


Alignment Length:116 Identity:51/116 - (43%)
Similarity:69/116 - (59%) Gaps:22/116 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 ASSYKMQRQAANVRERKRIQRSAPTGYTKCSINSAFDELRVHVPTFPYEKRLSKIDTLRLAIAYI 206
            ||....||||||:|||:|:|          |||.||:.||.|:||.||||||||:|||:|||:||
  Fly    81 ASQMAQQRQAANLRERRRMQ----------SINEAFEGLRTHIPTLPYEKRLSKVDTLKLAISYI 135

  Fly   207 SLLREVLQTD---YDPLTYVEKCLRGE-----IKADRANWNTSDLTARLSW 249
            :.|.|:::.|   .:|...:::..:.|     |..||    |..:...|||
  Fly   136 TFLSEMVKKDKNGNEPGLSLQRNYQKEPPKKIILKDR----TGGVAHSLSW 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2NP_001287359.1 HLH 148..210 CDD:278439 37/61 (61%)
Fer1NP_001262334.1 HLH 92..144 CDD:197674 34/61 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452819
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23349
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2562
SonicParanoid 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.