powered by:
Protein Alignment Fer2 and Id2
DIOPT Version :9
Sequence 1: | NP_001287359.1 |
Gene: | Fer2 / 41961 |
FlyBaseID: | FBgn0038402 |
Length: | 283 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_037192.1 |
Gene: | Id2 / 25587 |
RGDID: | 2859 |
Length: | 134 |
Species: | Rattus norvegicus |
Alignment Length: | 67 |
Identity: | 18/67 - (26%) |
Similarity: | 31/67 - (46%) |
Gaps: | 17/67 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 172 SINSAFDELRVHVPTFPYEKRLSKIDTLRLAIAYISLLREVL-----------------QTDYDP 219
::|..:.:|:..||:.|..|:::|::.|:..|.||..|:..| ||...|
Rat 38 NMNDCYSKLKELVPSIPQNKKVTKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQTSRTP 102
Fly 220 LT 221
||
Rat 103 LT 104
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.