DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer2 and id3

DIOPT Version :9

Sequence 1:NP_001287359.1 Gene:Fer2 / 41961 FlyBaseID:FBgn0038402 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_694499.1 Gene:id3 / 246093 ZFINID:ZDB-GENE-020515-1 Length:116 Species:Danio rerio


Alignment Length:47 Identity:14/47 - (29%)
Similarity:28/47 - (59%) Gaps:0/47 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 SINSAFDELRVHVPTFPYEKRLSKIDTLRLAIAYISLLREVLQTDYD 218
            ::|..:.:|:..||:.|..|.:|:::.|:..|.||..|:..|:.:.|
Zfish    41 NMNDCYSKLKELVPSIPQNKSVSQVEILQHVIDYIFDLQIALENETD 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer2NP_001287359.1 HLH 148..210 CDD:278439 11/37 (30%)
id3NP_694499.1 HLH <41..79 CDD:278439 11/37 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.