powered by:
Protein Alignment Fer2 and id3
DIOPT Version :9
Sequence 1: | NP_001287359.1 |
Gene: | Fer2 / 41961 |
FlyBaseID: | FBgn0038402 |
Length: | 283 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_694499.1 |
Gene: | id3 / 246093 |
ZFINID: | ZDB-GENE-020515-1 |
Length: | 116 |
Species: | Danio rerio |
Alignment Length: | 47 |
Identity: | 14/47 - (29%) |
Similarity: | 28/47 - (59%) |
Gaps: | 0/47 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 172 SINSAFDELRVHVPTFPYEKRLSKIDTLRLAIAYISLLREVLQTDYD 218
::|..:.:|:..||:.|..|.:|:::.|:..|.||..|:..|:.:.|
Zfish 41 NMNDCYSKLKELVPSIPQNKSVSQVEILQHVIDYIFDLQIALENETD 87
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Fer2 | NP_001287359.1 |
HLH |
148..210 |
CDD:278439 |
11/37 (30%) |
id3 | NP_694499.1 |
HLH |
<41..79 |
CDD:278439 |
11/37 (30%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.